PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G12760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 416aa    MW: 43471.8 Da    PI: 6.9793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G12760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+lv+++ ++G  +W++++++ g+ R++k+c++rw +yl
  LPERR07G12760.1 13 RGLWSPEEDEKLVHYISEHGHSCWSSVPKHAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding50.45.1e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  LPERR07G12760.1  66 RGTFSEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26463IPR009057Homeodomain-like
PROSITE profilePS5129419.069860IPR017930Myb domain
SuperFamilySSF466891.65E-2810107IPR009057Homeodomain-like
SMARTSM007173.8E-141262IPR001005SANT/Myb domain
PfamPF002491.4E-161360IPR001005SANT/Myb domain
CDDcd001671.60E-121660No hitNo description
PROSITE profilePS5129425.59761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2464116IPR009057Homeodomain-like
SMARTSM007171.4E-1565113IPR001005SANT/Myb domain
PfamPF002499.0E-1566109IPR001005SANT/Myb domain
CDDcd001671.48E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVHYISE HGHSCWSSVP KHAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPKTHNLLPA SKTLLHGVPA ANPSGNNNSN NNLAHFHSNG GAAAATAATT PFTISSPSKA  180
AAAFEVAPPA MYDVVVPNHH ATGGMMMGHD HNHHVAAAAA AAMARAGYHP YAENGNGGGV  240
LMSFRDQNGG GVVHAAASMD FMNGSSSSSS MEHHGGGGGM AANGNGFSAS MAAAFMDEEA  300
AMWATAVETP VSMAGLGGMD LPHQHQQQQL LVQESAAVVG PRPPTATLMM HGGGGAGAMV  360
DKGVVEMVDV SSEVYGGGAG AGAGATAFDL DLMVESCGMF GAGGGNAGIE QLQWDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645809.11e-175PREDICTED: myb-related protein Hv33
TrEMBLA0A0D9WZ410.0A0A0D9WZ41_9ORYZ; Uncharacterized protein
STRINGORGLA07G0124200.11e-180(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-80myb domain protein 67